Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ubiquitin-like protein FUBI (Fau)

This Recombinant Mouse Ubiquitin-like protein FUBI (Fau) spans the amino acid sequence from region 1-74aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Monoclonal non-specific suppressor factor beta) (MNSF-beta)

UniProt

P35545

Expression Region

1-74aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQLFVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Col27a1 shRNA (UAS) - Lentiviral mouse Col27a1 shRNA (UAS, iRFP) (100)
GTR15274311 1 Vial

Lentiviral mouse Col27a1 shRNA (UAS) - Lentiviral mouse Col27a1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Avpi1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
12881114 3x 1.0 µg

Avpi1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Cdk2 3'UTR Lenti-reporter-Luc Vector
15696084 1.0 µg

Cdk2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
HNRNPH3, ID (HNRNPH3, HNRPH3, Heterogeneous nuclear ribonucleoprotein H3, Heterogeneous nuclear ribonucleoprotein 2H9) (MaxLight 750) discontinued
036666-ML750 100 µL

HNRNPH3, ID (HNRNPH3, HNRPH3, Heterogeneous nuclear ribonucleoprotein H3, Heterogeneous nuclear ribonucleoprotein 2H9) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit Anti KRT5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAMLKRT5AP147200UL 200 µL

Rabbit Anti KRT5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details
Phospho-LAT (Tyr191) Antibody (YA1021, Rabbit)
HY-P81297-01 10 µL

Phospho-LAT (Tyr191) Antibody (YA1021, Rabbit)

Sign In for Pricing
View Details