Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Immunoglobulin A1 protease (iga), partial

This Recombinant Streptococcus pneumoniae Immunoglobulin A1 protease (iga), partial spans the amino acid sequence from region 313-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IgA1 protease) (IgA-specific zinc metalloproteinase)

UniProt

Q54875

Expression Region

313-393aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Streptococcus pneumoniae

Field of Research

Protein Biochemistry

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NKPELLYREETIETKIDFQEEIQENPDLAEGTVRVKQEGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIVEKGTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RILPL2 Polyclonal Antibody
E-AB-18411-01 20 µL

RILPL2 Polyclonal Antibody

Sign In for Pricing
View Details
RILPL2 Polyclonal Antibody
E-AB-18411-02 60 µL

RILPL2 Polyclonal Antibody

Sign In for Pricing
View Details
RILPL2 Polyclonal Antibody
E-AB-18411-03 120 µL

RILPL2 Polyclonal Antibody

Sign In for Pricing
View Details
RILPL2 Polyclonal Antibody
E-AB-18411-04 200 µL

RILPL2 Polyclonal Antibody

Sign In for Pricing
View Details
FBXO24 (Center) Rabbit Polyclonal Antibody
AP51628PU-N 400 µL

FBXO24 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF740 conjugate, 0.1mg/mL
BNC743340-100 1x 100 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details