Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Immunoglobulin A1 protease (iga), partial

This Recombinant Streptococcus pneumoniae Immunoglobulin A1 protease (iga), partial spans the amino acid sequence from region 313-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IgA1 protease) (IgA-specific zinc metalloproteinase)

UniProt

Q54875

Expression Region

313-393aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Streptococcus pneumoniae

Field of Research

Protein Biochemistry

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NKPELLYREETIETKIDFQEEIQENPDLAEGTVRVKQEGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIVEKGTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GK3P CRISPR All-in-one AAV vector set (with saCas9)(Human)
21561151 3x 1.0 µg DNA

GK3P CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Anti-TFIIH p89 Antibody
CQA4386-01 100 µL

Anti-TFIIH p89 Antibody

Sign In for Pricing
View Details
Anti-TFIIH p89 Antibody
CQA4386-02 200 µL

Anti-TFIIH p89 Antibody

Sign In for Pricing
View Details
Anti-Human CLDN1/Claudin-1 Antibody (6F6C3), FITC
FHB76111 100 Tests

Anti-Human CLDN1/Claudin-1 Antibody (6F6C3), FITC

Sign In for Pricing
View Details
Tert-Butyl 6-bromo-2,3-dihydrospiro[indene-1,4'-piperidine]-1'-carboxylate
KWB24739-01 50 mg

Tert-Butyl 6-bromo-2,3-dihydrospiro[indene-1,4'-piperidine]-1'-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 6-bromo-2,3-dihydrospiro[indene-1,4'-piperidine]-1'-carboxylate
KWB24739-02 0.5 g

Tert-Butyl 6-bromo-2,3-dihydrospiro[indene-1,4'-piperidine]-1'-carboxylate

Sign In for Pricing
View Details