Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse LysM and putative peptidoglycan-binding domain-containing protein 3 (Lysmd3), partial

This Recombinant Mouse LysM and putative peptidoglycan-binding domain-containing protein 3 (Lysmd3), partial spans the amino acid sequence from region 1-216aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q99LE3

Expression Region

1-216aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGRNQNRTVSLPGIQASGHVLAFGNCTDNDMLEEDAEVYELRSRGKEKVRRSASRDRLDDIVILTKDIQEGDTLNAVALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKRFSSLTETLHPLKGRHILHPPPVPYFQEQDIVPADGSLSSSESAGSFLKEVDRDIEQIVKCTDTKKENLNEVVSALTAQQVRFEPDNKSIHRKDPYYGADWGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Id4 Pre-designed siRNA Set B
SI206536B 1 Each

Rat Id4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SPATS2 (NM_023071) Human Tagged ORF Clone Lentiviral Particle
RC208246L1V 200 µL

SPATS2 (NM_023071) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (AP)
MBS6340718-01 0.2 mL

RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (AP)

Sign In for Pricing
View Details
RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (AP)
MBS6340718-02 5x 0.2 mL

RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (AP)

Sign In for Pricing
View Details
SLC10A1 Protein Vector (Mouse) (pPM-C-His)
PV229573 500 ng

SLC10A1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rps8 Antibody - C-terminal region : Biotin (ARP56156_P050-Biotin)
ARP56156_P050-Biotin 100 µL

Rps8 Antibody - C-terminal region : Biotin (ARP56156_P050-Biotin)

Sign In for Pricing
View Details