Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adrenodoxin, mitochondrial (FDX1)

This Recombinant Human Adrenodoxin, mitochondrial (FDX1) spans the amino acid sequence from region 61-184aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Adrenal ferredoxin) (Ferredoxin-1) (Hepatoredoxin)

UniProt

P10109

Expression Region

61-184aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kir4.1 (KCNJ10) (NM_002241) Human Over-expression Lysate
LY419446 100 µg

Kir4.1 (KCNJ10) (NM_002241) Human Over-expression Lysate

Sign In for Pricing
View Details
CDC42 (NM_044472) Human Recombinant Protein
TP316559 20 µg

CDC42 (NM_044472) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant ANXA1 Antibody
RC-4204-01 50 μL

Recombinant ANXA1 Antibody

Sign In for Pricing
View Details
Recombinant ANXA1 Antibody
RC-4204-02 100 µL

Recombinant ANXA1 Antibody

Sign In for Pricing
View Details
Recombinant ANXA1 Antibody
RC-4204-03 1 mL

Recombinant ANXA1 Antibody

Sign In for Pricing
View Details
2-Bromoethyl-4-nitrophenyl Ether-d4
TRC-B684262-25MG 25 mg

2-Bromoethyl-4-nitrophenyl Ether-d4

Sign In for Pricing
View Details