Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacteroides abscessus ESAT-6-like protein

This Recombinant Mycobacteroides abscessus ESAT-6-like protein (D2E76_02620) spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A0U0YS08

Expression Region

1-92aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacteroides abscessus

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVFQNDLALLDSTAKKIDGKYQEFTAMQSQLRDRVAVGTSTWQGQARHAFDEAMARFDQEMGDIQKVLIGIHDTMESNKRRIQEMDESQTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myomegalin (h2) : 293T Lysate
sc-372427 100 µg - 200 µL

Myomegalin (h2) : 293T Lysate

Sign In for Pricing
View Details
Human LTB (NM_009588) AAV Particle
RC224068A1V 250 µL

Human LTB (NM_009588) AAV Particle

Sign In for Pricing
View Details
Canine Neonatal Thyroxine (NN-T4) ELISA Kit
EIA06399Ca 1 Kit

Canine Neonatal Thyroxine (NN-T4) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal C-Peptide Antibody (CC34)
NBP1-05433 0.2 mg

Mouse Monoclonal C-Peptide Antibody (CC34)

Sign In for Pricing
View Details
Lentiviral mouse Ceacam13 shRNA (UAS) - Lentiviral mouse Ceacam13 shRNA (UAS) (100)
GTR15182262 1 Vial

Lentiviral mouse Ceacam13 shRNA (UAS) - Lentiviral mouse Ceacam13 shRNA (UAS) (100)

Sign In for Pricing
View Details
MCM-BP Antibody
E38QA1156 100 µL

MCM-BP Antibody

Sign In for Pricing
View Details