Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacteroides abscessus ESAT-6-like protein (esxT)

This Recombinant Mycobacteroides abscessus ESAT-6-like protein (esxT) spans the amino acid sequence from region 1-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A0U0WZP7

Expression Region

1-96aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacteroides abscessus

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQITYNHGEIDALVADVKGIINKFQAGLEELQHDIQPLVQQAEGQEATAYQEYQKAWHQSAEDLNQILTQLNAKVDQGNQDAQHTDQSAAGAWHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf22 Knockout HEK293T Polyclonal Cells
ARG41493 1 Million

C5orf22 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Human Renal Proximal Tubular Epithelial Cells
ABC-TC3786 1 Vial

Human Renal Proximal Tubular Epithelial Cells

Sign In for Pricing
View Details
Human RAB9B Protein Lysate
MBS8418226-01 0.02 mg

Human RAB9B Protein Lysate

Sign In for Pricing
View Details
Human RAB9B Protein Lysate
MBS8418226-02 5x 0.02 mg

Human RAB9B Protein Lysate

Sign In for Pricing
View Details
Protein A (HRP) (Lyophilized)
MBS635436-01 1 mg

Protein A (HRP) (Lyophilized)

Sign In for Pricing
View Details
Protein A (HRP) (Lyophilized)
MBS635436-02 5x 1 mg

Protein A (HRP) (Lyophilized)

Sign In for Pricing
View Details