Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Amelogenin, X isoform (Amelx)

This Recombinant Mouse Amelogenin, X isoform (Amelx) spans the amino acid sequence from region 17-210aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Leucine-rich amelogenin peptide) (LRAP)

UniProt

P63277

Expression Region

17-210aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPLPPHPGSPGYINLSYEKSHSQAINTDRTALVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse calcium/calmodulin-dependent protein kinase-II (CAMK2) ELISA Kit
201-02-1614 96 Tests

Mouse calcium/calmodulin-dependent protein kinase-II (CAMK2) ELISA Kit

Sign In for Pricing
View Details
Recombinant LETM1 Domain Containing Protein 1 (LETMD1)
SIPR501Hu01-01 10 µg

Recombinant LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details
Recombinant LETM1 Domain Containing Protein 1 (LETMD1)
SIPR501Hu01-02 50 µg

Recombinant LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details
Recombinant LETM1 Domain Containing Protein 1 (LETMD1)
SIPR501Hu01-03 200 µg

Recombinant LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details
Recombinant LETM1 Domain Containing Protein 1 (LETMD1)
SIPR501Hu01-04 1 mg

Recombinant LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details
Recombinant LETM1 Domain Containing Protein 1 (LETMD1)
SIPR501Hu01-05 5 mg

Recombinant LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details