Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Amelotin (Amtn)

This Recombinant Mouse Amelotin (Amtn) spans the amino acid sequence from region 17-213aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9D3J8

Expression Region

17-213aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPKQLNPASGVPATKPTPGQVTPLPQQQPNQVFPSISLIPLTQLLTLGSDLPLFNPAAGPHGAHTLPFTLGPLNGQQQLQPQMLPIIVAQLGAQGALLSSEELPLASQIFTGLLIHPLFPGAIPPSGQAGTKPDVQNGVLPTRQAGAKAVNQGTTPGHVTTPGVTDDDDYEMSTPAGLRRATHTTEGTTIDPPNRTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20 μL Robotic Filter Tips for Tecan, Clear, Sterile, Boxed, SBS format, Compatible with AutoMATE system, 96/rack, 24 racks/cs
CS0035-332318 1 Each

20 μL Robotic Filter Tips for Tecan, Clear, Sterile, Boxed, SBS format, Compatible with AutoMATE system, 96/rack, 24 racks/cs

Sign In for Pricing
View Details
MGC94190 sgRNA CRISPR Lentivector set (Rat)
K6389501 3x 1.0 µg

MGC94190 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-IL23 Receptor/IL23R Antibody Picoband®, Dylight550 Conjugate
A00607-3-Dylight550 100 µg

Anti-IL23 Receptor/IL23R Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Rat Anti-Type II Collagen AutoAntibody ELISA Kit
MBS723469-01 48 Strip Well

Rat Anti-Type II Collagen AutoAntibody ELISA Kit

Sign In for Pricing
View Details
Rat Anti-Type II Collagen AutoAntibody ELISA Kit
MBS723469-02 96 Strip Well

Rat Anti-Type II Collagen AutoAntibody ELISA Kit

Sign In for Pricing
View Details
Rat Anti-Type II Collagen AutoAntibody ELISA Kit
MBS723469-03 5x 96 Strip Well

Rat Anti-Type II Collagen AutoAntibody ELISA Kit

Sign In for Pricing
View Details