Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 5B (EIF5B), partial

This Recombinant Human Eukaryotic translation initiation factor 5B (EIF5B), partial spans the amino acid sequence from region 629-846aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(eIF-5B) (Translation initiation factor IF-2)

UniProt

O60841

Expression Region

629-846aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTML

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETEA/UBXD8 (D8H6D) Rabbit Monoclonal Antibody
CST 34945T 20 µL

ETEA/UBXD8 (D8H6D) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human GNA11 Protein, N-His
AP91394 50 µg

Recombinant Human GNA11 Protein, N-His

Sign In for Pricing
View Details
GYY 4137
GL7524-50mg 50 mg

GYY 4137

Sign In for Pricing
View Details
Rabbit anti-Mycobacterium tuberculosis Antigen 85-A polyclonal Antibody
MBS1490476-01 0.05 mg

Rabbit anti-Mycobacterium tuberculosis Antigen 85-A polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Mycobacterium tuberculosis Antigen 85-A polyclonal Antibody
MBS1490476-02 0.1 mg

Rabbit anti-Mycobacterium tuberculosis Antigen 85-A polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Mycobacterium tuberculosis Antigen 85-A polyclonal Antibody
MBS1490476-03 5x 0.1 mg

Rabbit anti-Mycobacterium tuberculosis Antigen 85-A polyclonal Antibody

Sign In for Pricing
View Details