Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CCR4-NOT transcription complex subunit 7 (CNOT7)

This Recombinant Human CCR4-NOT transcription complex subunit 7 (CNOT7) spans the amino acid sequence from region 1-285aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BTG1-binding factor 1) (CCR4-associated factor 1) (CAF-1) (Caf1a)

UniProt

Q9UIV1

Expression Region

1-285aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitrosodiphenyl-2,2',4,4',6,6'-d6-amine
TRC-N525776-1MG 1 mg

N-Nitrosodiphenyl-2,2',4,4',6,6'-d6-amine

Sign In for Pricing
View Details
Human Melanoma CAFs
CAF09 1000000 Cells

Human Melanoma CAFs

Sign In for Pricing
View Details
GRIN1 Polyclonal Antibody
E-AB-68400-01 60 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
GRIN1 Polyclonal Antibody
E-AB-68400-02 120 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
GRIN1 Polyclonal Antibody
E-AB-68400-03 200 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant MVP Antibody
RC-4948-01 50 μL

Recombinant MVP Antibody

Sign In for Pricing
View Details