RSPO1/R-spondin-1, Human (HEK293, His)

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

[1]Qu M, et al. Establishment of intestinal organoid cultures modeling injury-associated epithelial regeneration. Cell Res. 2021 Mar;31 (3) :259-271.|[2]Levin G, et al. R-Spondin 1 (RSPO1) Increases Mouse Intestinal Organoid Unit Size and Survival in vitro and Improves Tissue-Engineered Small Intestine Formation in vivo. Front Bioeng Biotechnol. 2020 Jun 5;8:476. |[3]Dossena M, et al. Standardized GMP-compliant scalable production of human pancreas organoids. Stem Cell Res Ther. 2020 Mar 4;11 (1) :94.|[4]Levin G, et al. Production, purification and characterization of recombinant human R-spondin1 (RSPO1) protein stably expressed in human HEK293 cells. BMC Biotechnol. 2020 Jan 20;20 (1) :5.|[5]Silvano S, et al. RSPO1, a potent inducer of pancreatic β cell neogenesis. Cell Rep Med. 2025 May 20;6 (5) :102126. |[6]Wang H, et al. R-Spondin 1 promotes vibration-induced bone formation in mouse models of osteoporosis. J Mol Med (Berl) . 2013 Dec;91 (12) :1421-9.|[7]Krönke G, et al. R-spondin 1 protects against inflammatory bone damage during murine arthritis by modulating the Wnt pathway. Arthritis Rheum. 2010 Aug;62 (8) :2303-12.