Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Major capsid protein (MCP), partial

This Recombinant Human cytomegalovirus Major capsid protein (MCP), partial spans the amino acid sequence from region 1-200aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MCP)

UniProt

P16729

Expression Region

1-200aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MENWSALELLPKVGIPTDFLTHVKTSAGEEMFEALRIYYGDDPERYNIHFEAIFGTFCNRLEWVYFLTSGLAAAAHAIKFHDLNKLTTGKMLFHVQVPRVASGAGLPTSRQTTIMVTKYSEKSPITIPFELSAACLTYLRETFEGTILDKILNVEAMHTVLRALKNTADAMERGLIHSFLQTLLRKAPPYFVVQTLVENA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Acetyl-CoA Carboxylase [p Ser79] Antibody
NBP3-33573-20ul 20 µL

Rabbit Monoclonal Acetyl-CoA Carboxylase [p Ser79] Antibody

Sign In for Pricing
View Details
3-Amino-3-benzyl-3,4-dihydroquinolin-2 (1H) -one
423740-01 25 mg

3-Amino-3-benzyl-3,4-dihydroquinolin-2 (1H) -one

Sign In for Pricing
View Details
3-Amino-3-benzyl-3,4-dihydroquinolin-2 (1H) -one
423740-02 50 mg

3-Amino-3-benzyl-3,4-dihydroquinolin-2 (1H) -one

Sign In for Pricing
View Details
Syntaxin 3 (STX3) (NM_004177) Human Mass Spec Standard
PH300658 10 µg

Syntaxin 3 (STX3) (NM_004177) Human Mass Spec Standard

Sign In for Pricing
View Details
USO1 (US01 Homolog, TAP, Vesicle Docking Protein p115, Vesicle-Docking Protein, US01, USO1 Vesicle Transport Factor, VDP) discontinued
228346 50 µg

USO1 (US01 Homolog, TAP, Vesicle Docking Protein p115, Vesicle-Docking Protein, US01, USO1 Vesicle Transport Factor, VDP) discontinued

Sign In for Pricing
View Details
SH3RF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV663561 1.0 µg DNA

SH3RF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details