Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 18 Probable protein E5 (E5)

This Recombinant Human papillomavirus type 18 Probable protein E5 (E5) spans the amino acid sequence from region 1-73aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P06792

Expression Region

1-73aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Human papillomavirus type 18

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSLIFLFCFCVCMYVCCHVPLLPSVCMCAYAWVLVFVYIVVITSPATAFTVYVFCFLLPMLLLHIHAILSLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MATN4 3'UTR Luciferase Stable Cell Line
TU013053 1.0 mL

MATN4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CB081 Rabbit Polyclonal Antibody
JOT-AP01116-01 20 µL

CB081 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CB081 Rabbit Polyclonal Antibody
JOT-AP01116-02 50 μL

CB081 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CB081 Rabbit Polyclonal Antibody
JOT-AP01116-03 100 µL

CB081 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-BOLA1 Antibody
CTA4129-01 30 µL

Anti-BOLA1 Antibody

Sign In for Pricing
View Details
Anti-BOLA1 Antibody
CTA4129-02 50 μL

Anti-BOLA1 Antibody

Sign In for Pricing
View Details