Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein flightless-1 homolog (FLII), partial

This Recombinant Human Protein flightless-1 homolog (FLII), partial spans the amino acid sequence from region 495-827aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q13045

Expression Region

495-827aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf168 Protein Vector (Human) (pPB-His-MBP)
PV330354 500 ng

C20orf168 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Cytokeratin 5,8 (MaxLight 405) discontinued
C9097-37D-ML405 100 µL

Cytokeratin 5,8 (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit anti-CASC3 IHC Antibody, Affinity Purified
IHC-00690-T 2.5 µg

Rabbit anti-CASC3 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Gallus, glandular stomach t.s.
Av114c 7.6 x 2.6 cm

Gallus, glandular stomach t.s.

Sign In for Pricing
View Details
PGK1 (10K19) Rabbit Monoclonal Antibody
E28M0596 100 µL

PGK1 (10K19) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SNTG2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45013061 1.0 µg DNA

SNTG2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details