Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Granzyme K (GZMK)

This Recombinant Human Granzyme K (GZMK) spans the amino acid sequence from region 27-264aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Fragmentin-3) (Granzyme-3) (NK-tryptase-2) (NK-Tryp-2)

UniProt

P49863

Expression Region

27-264aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANTXR1 Antibody - middle region : HRP (ARP50040_P050-HRP)
ARP50040_P050-HRP 100 µL

ANTXR1 Antibody - middle region : HRP (ARP50040_P050-HRP)

Sign In for Pricing
View Details
CD62L / SELL Monoclonal Antibody
ANT-11281-50ug 50 µg

CD62L / SELL Monoclonal Antibody

Sign In for Pricing
View Details
ZNF319 (NM_020807) Human 3' UTR Clone
SC216738 10 µg

ZNF319 (NM_020807) Human 3' UTR Clone

Sign In for Pricing
View Details
MYF5, NT (MYF5, BHLHC2, Myogenic factor 5, Class C basic helix-loop-helix protein 2) (MaxLight 750) discontinued
038728-ML750 100 µL

MYF5, NT (MYF5, BHLHC2, Myogenic factor 5, Class C basic helix-loop-helix protein 2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
WAS (Wiskott-Aldrich Syndrome Protein, THC, IMD2, SCNX, THC1, WASP)
368982 100 µL

WAS (Wiskott-Aldrich Syndrome Protein, THC, IMD2, SCNX, THC1, WASP)

Sign In for Pricing
View Details
IL2RB Antibody
MBS7119676-01 0.05 mg

IL2RB Antibody

Sign In for Pricing
View Details