Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1), partial

This Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1), partial spans the amino acid sequence from region 2-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GST 1-1) (GST class-mu 1) (Glutathione S-transferase GT8.7) (pmGT10)

UniProt

P10649

Expression Region

2-218aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOB Knockout SK-HEP-1 Polyclonal Cells
ARG32215 1 Million

APOB Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
Rhox7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3012108 1.0 µg DNA

Rhox7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Desi1 (NM_134095) Mouse Recombinant Protein
PM48653M5 20 µg

Desi1 (NM_134095) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human BEST1 Protein
ARP1323-01 10 µg

Recombinant Human BEST1 Protein

Sign In for Pricing
View Details
Recombinant Human BEST1 Protein
ARP1323-02 50 µg

Recombinant Human BEST1 Protein

Sign In for Pricing
View Details
Recombinant Human BEST1 Protein
ARP1323-03 100 µg

Recombinant Human BEST1 Protein

Sign In for Pricing
View Details