Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 1 (IGLC1)

This Recombinant Human Immunoglobulin lambda constant 1 (IGLC1) spans the amino acid sequence from region 1-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Ig lambda chain C region MGC) (Ig lambda-1 chain C region)

UniProt

P0CG04

Expression Region

1-106aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNDC5 Polyclonal Antibody, PE Conjugated
bs-8486R-PE 100 µL

FNDC5 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Bovine Fibulin 1 (FBLN1) ELISA Kit
MBS1603326-01 48 Well

Bovine Fibulin 1 (FBLN1) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibulin 1 (FBLN1) ELISA Kit
MBS1603326-02 96 Well

Bovine Fibulin 1 (FBLN1) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibulin 1 (FBLN1) ELISA Kit
MBS1603326-03 5x 96 Well

Bovine Fibulin 1 (FBLN1) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibulin 1 (FBLN1) ELISA Kit
MBS1603326-04 10x 96 Well

Bovine Fibulin 1 (FBLN1) ELISA Kit

Sign In for Pricing
View Details
BACE Antibody (S498)
MBS9205538-01 0.08 mL

BACE Antibody (S498)

Sign In for Pricing
View Details