Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 1 (IGLC1)

This Recombinant Human Immunoglobulin lambda constant 1 (IGLC1) spans the amino acid sequence from region 1-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Ig lambda chain C region MGC) (Ig lambda-1 chain C region)

UniProt

P0CG04

Expression Region

1-106aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ncaph2 (NM_001271601) AAV Particle
MR230664A1V 250 µL

Mouse Ncaph2 (NM_001271601) AAV Particle

Sign In for Pricing
View Details
GLUDP8 siRNA Oligos set (Human)
58091171 3x 5 nmol

GLUDP8 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Human MAGEC2 Protein
E30P62953A 50 µg

Recombinant Human MAGEC2 Protein

Sign In for Pricing
View Details
AGXT2L2 (PP9286, 5-phosphohydroxy-L-lysine phospho-lyase, Alanine--glyoxylate aminotransferase 2-like 2)
305242-01 50 µL

AGXT2L2 (PP9286, 5-phosphohydroxy-L-lysine phospho-lyase, Alanine--glyoxylate aminotransferase 2-like 2)

Sign In for Pricing
View Details
AGXT2L2 (PP9286, 5-phosphohydroxy-L-lysine phospho-lyase, Alanine--glyoxylate aminotransferase 2-like 2)
305242-02 100 µL

AGXT2L2 (PP9286, 5-phosphohydroxy-L-lysine phospho-lyase, Alanine--glyoxylate aminotransferase 2-like 2)

Sign In for Pricing
View Details
Recombinant Human WNT10A Protein
E30P01727A 50 µg

Recombinant Human WNT10A Protein

Sign In for Pricing
View Details