Recombinant Human Leukocyte surface antigen CD47 (CD47), partial, Biotinylated
This Recombinant Human Leukocyte surface antigen CD47 (CD47), partial, Biotinylated spans the amino acid sequence from region 19-139aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(Antigenic surface determinant protein OA3) (Integrin-associated protein) (IAP) (Protein MER6) (CD antigen CD47)
UniProt
Q08722
Expression Region
19-139aa
Tag
C-terminal hFc1-Avi-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation; Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
43.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M2430-99P-FITC 100 µL
Matrix Metalloproteinase 16, Prodomain (Matrix Metallopeptidase 16 (Membrane-inserted), MMP-16, MMP16, C8orf57, DKFZp761D112, Membrane-type Matrix Metalloproteinase 3, MT-MMP 3, MTMMP3, Membrane-type-3 Matrix Metalloproteinase, MT3-MMP, MT3MMP, MMP-X2, MMPX2) (FITC) discontinued
Sign In for Pricing
View Details 
