Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell antigen CD7 (CD7), partial, Biotinylated

This Recombinant Human T-cell antigen CD7 (CD7), partial, Biotinylated spans the amino acid sequence from region 26-180aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GP40) (T-cell leukemia antigen) (T-cell surface antigen Leu-9) (TP41) (CD antigen CD7)

UniProt

P09564

Expression Region

26-180aa

Tag

C-terminal mFc-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-O- (α-D-Galactopyranosyl) -β-D-thioglucopyranose
OG10932-01 10 mg

6-O- (α-D-Galactopyranosyl) -β-D-thioglucopyranose

Sign In for Pricing
View Details
6-O- (α-D-Galactopyranosyl) -β-D-thioglucopyranose
OG10932-02 25 mg

6-O- (α-D-Galactopyranosyl) -β-D-thioglucopyranose

Sign In for Pricing
View Details
Glycerol kinase (3Z15) Rabbit Monoclonal Antibody
E28M6539 100 µL

Glycerol kinase (3Z15) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TICAM2 sgRNA CRISPR Lentivector (Human) (Target 1)
K2373102 1.0 µg DNA

TICAM2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2148671-01 0.1 mL

PE-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2148671-02 0.2 mL

PE-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details