Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma (IFNG)

This Recombinant Human Interferon gamma (IFNG), partial spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immune interferon

UniProt

P01579

Expression Region

24-166aa

Tag

N-terminal hFc-Flag-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Calreticulin-2/CALR3 Antibody
NBP2-33390-25ul 25 µL

Rabbit Polyclonal Calreticulin-2/CALR3 Antibody

Sign In for Pricing
View Details
Human Cluster Of Differentiation 86 (CD86) ELISA Kit
EKN43838 96 Tests

Human Cluster Of Differentiation 86 (CD86) ELISA Kit

Sign In for Pricing
View Details
INSR Antibody
orb675137-01 50 µg

INSR Antibody

Sign In for Pricing
View Details
INSR Antibody
orb675137-02 100 µg

INSR Antibody

Sign In for Pricing
View Details
Human C1orf115 knockdown cell line
ABC-KD1876 1 Vial

Human C1orf115 knockdown cell line

Sign In for Pricing
View Details
LRRC19 Antibody
42917 100 µL

LRRC19 Antibody

Sign In for Pricing
View Details