What sizes are available for Recombinant Human Leukemia inhibitory factor (LIF) (Active)?

Recombinant Human Leukemia inhibitory factor (LIF) (Active) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Leukemia inhibitory factor (LIF) (Active) come in?

Recombinant Human Leukemia inhibitory factor (LIF) (Active) is available in 3 different pack sizes.

Recombinant Human Leukemia inhibitory factor (LIF) (Active)

Q: What is the catalog number for Recombinant Human Leukemia inhibitory factor (LIF) (Active)?

The catalog number for Recombinant Human Leukemia inhibitory factor (LIF) (Active) is orb1785348.

This Recombinant Human Leukemia inhibitory factor (LIF) spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LIF) (Differentiation-stimulating factor) (D factor) (Melanoma-derived LPL inhibitor) (MLPLI) (Emfilermin)

UniProt

P15018

Expression Region

23-202aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human LIF at 2 μg/mL can bind Human LIFR protein. The EC50 is 8.067-9.260 ng/mL.

Form

Lyophilized powder

Molecular Weight

23.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF