Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphotoxin-alpha (LTA), partial, Biotinylated

This Recombinant Human Lymphotoxin-alpha (LTA), partial, Biotinylated spans the amino acid sequence from region 35-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LT-alpha) (TNF-beta) (Tumor necrosis factor ligand superfamily member 1)

UniProt

P01374

Expression Region

35-205aa

Tag

N-terminal 6xHis-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monocyte Chemotactic Protein 1 (MCP1) ELISA Kit
DLR-MCP1-Ra-48T 48 Tests

Rat Monocyte Chemotactic Protein 1 (MCP1) ELISA Kit

Sign In for Pricing
View Details
2,4-Dibromo-1-methoxynaphthalene
OR1064121-01 1 g

2,4-Dibromo-1-methoxynaphthalene

Sign In for Pricing
View Details
2,4-Dibromo-1-methoxynaphthalene
OR1064121-02 5 g

2,4-Dibromo-1-methoxynaphthalene

Sign In for Pricing
View Details
2,4-Dibromo-1-methoxynaphthalene
OR1064121-03 10 g

2,4-Dibromo-1-methoxynaphthalene

Sign In for Pricing
View Details
CYTIP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0557908 1.0 µg DNA

CYTIP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
LANPL Rabbit Polyclonal Antibody (FITC)
orb102896 100 µL

LANPL Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details