Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oncostatin-M (OSM), partial (Active)

This Recombinant Human Oncostatin-M (OSM), partial (Active) spans the amino acid sequence from region 26-221aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(OSM)

UniProt

P13725

Expression Region

26-221aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human OSM at 2 μg/mL can bind Anti-OSM recombinant antibody, the EC50 is 3.048-3.860 ng/mL.

Form

Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EFNA4 Antibody (PF-06647263)
F1684-5 5 mg

Anti-EFNA4 Antibody (PF-06647263)

Sign In for Pricing
View Details
ZIC1/2/3 Antibody
MBS9600274-01 0.1 mL

ZIC1/2/3 Antibody

Sign In for Pricing
View Details
ZIC1/2/3 Antibody
MBS9600274-02 0.2 mL

ZIC1/2/3 Antibody

Sign In for Pricing
View Details
ZIC1/2/3 Antibody
MBS9600274-03 5x 0.2 mL

ZIC1/2/3 Antibody

Sign In for Pricing
View Details
Ac2-26
orb1140478 1 mg

Ac2-26

Sign In for Pricing
View Details
Sodium 4-Decylbenzenesulfonate
166542 100 mg

Sodium 4-Decylbenzenesulfonate

Sign In for Pricing
View Details