Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oncostatin-M (OSM), partial

This Recombinant Human Oncostatin-M (OSM), partial spans the amino acid sequence from region 26-221aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(OSM)

UniProt

P13725

Expression Region

26-221aa

Tag

N-terminal hFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCP1B (NM_152640) Human Tagged ORF Clone
RG207398 10 µg

DCP1B (NM_152640) Human Tagged ORF Clone

Sign In for Pricing
View Details
CYB5A Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV678833 1.0 µg DNA

CYB5A Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ID099 For high level disinfection
DI837-01 500 mL

ID099 For high level disinfection

Sign In for Pricing
View Details
ID099 For high level disinfection
DI837-02 5 L

ID099 For high level disinfection

Sign In for Pricing
View Details
Phospho-Calmodulin 1/2/3 (Ser102) Rabbit pAb
E47R8519 100 µL

Phospho-Calmodulin 1/2/3 (Ser102) Rabbit pAb

Sign In for Pricing
View Details
Anti-Human PSCA Antibody (Ha1-4.117), PerCp
HT361247-01 1 Each

Anti-Human PSCA Antibody (Ha1-4.117), PerCp

Sign In for Pricing
View Details