Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 1 (IGLC1)

This Recombinant Human Immunoglobulin lambda constant 1 (IGLC1) spans the amino acid sequence from region 1-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Ig lambda chain C region MGC) (Ig lambda-1 chain C region)

UniProt

P0CG04

Expression Region

1-106aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pla2g4e sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3577004 1.0 µg DNA

Pla2g4e sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
FGFR3 Antibody, mAb, Rabbit
A03559-100 100 µL

FGFR3 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
ACP5, NT (ACP5, Tartrate-resistant acid phosphatase type 5, Tartrate-resistant acid ATPase, Type 5 acid phosphatase) (MaxLight 750)
MBS6271033-01 0.1 mL

ACP5, NT (ACP5, Tartrate-resistant acid phosphatase type 5, Tartrate-resistant acid ATPase, Type 5 acid phosphatase) (MaxLight 750)

Sign In for Pricing
View Details
ACP5, NT (ACP5, Tartrate-resistant acid phosphatase type 5, Tartrate-resistant acid ATPase, Type 5 acid phosphatase) (MaxLight 750)
MBS6271033-02 5x 0.1 mL

ACP5, NT (ACP5, Tartrate-resistant acid phosphatase type 5, Tartrate-resistant acid ATPase, Type 5 acid phosphatase) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Eosinophil cationic protein (ECP) ELISA Kit
AE63247MO-01 48 Tests

Mouse Eosinophil cationic protein (ECP) ELISA Kit

Sign In for Pricing
View Details
Mouse Eosinophil cationic protein (ECP) ELISA Kit
AE63247MO-02 96 Tests

Mouse Eosinophil cationic protein (ECP) ELISA Kit

Sign In for Pricing
View Details