Recombinant Human Proprotein convertase subtilisin/kexin type 6 (PCSK6), partial
This Recombinant Human Proprotein convertase subtilisin/kexin type 6 (PCSK6), partial spans the amino acid sequence from region 860-969aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(Paired basic amino acid cleaving enzyme 4) (Subtilisin-like proprotein convertase 4) (SPC4) (Subtilisin/kexin-like protease PACE4)
UniProt
P29122
Expression Region
860-969aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
43.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
I7651-58A-ML405 100 µL
Influenza B, Lee 40, Singapore 222/79, Nucleoprotein (MaxLight 405) discontinued
Sign In for Pricing
View Details BAL3334 1 Each
[IHC]Myeloperoxidase Rabbit Monoclonal Antibody, 1 pack = 50 µL
Sign In for Pricing
View Details bs-8265R-BF488 100 µL
DHRS7C Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
Sign In for Pricing
View Details 