Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poliovirus receptor (PVR), partial

This Recombinant Human Poliovirus receptor (PVR), partial spans the amino acid sequence from region 21-343aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Nectin-like protein 5) (NECL-5) (CD antigen CD155)

UniProt

P15151

Expression Region

21-343aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Cecum
CS639140 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
Aida Mouse Gene Knockout Kit (CRISPR)
KN501035 1 Kit

Aida Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Gyromitrin
TRC-G931900-1G 1 g

Gyromitrin

Sign In for Pricing
View Details
MALT1 Mouse Monoclonal Antibody [Clone ID: OTI1E4]
CF807308 100 µg

MALT1 Mouse Monoclonal Antibody [Clone ID: OTI1E4]

Sign In for Pricing
View Details
Rgs5 Mouse Gene Knockout Kit (CRISPR)
KN514741 1 Kit

Rgs5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Rabbit Anti-GS-ll Antibody
HAL-2402-1 1 mL

Horseradish Peroxidase Conjugated Rabbit Anti-GS-ll Antibody

Sign In for Pricing
View Details