Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poliovirus receptor (PVR), partial

This Recombinant Human Poliovirus receptor (PVR), partial spans the amino acid sequence from region 21-343aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Nectin-like protein 5) (NECL-5) (CD antigen CD155)

UniProt

P15151

Expression Region

21-343aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitrophenyl 4,6-O-Benzylidene-Alpha-D-mannopyranoside
TRC-N494125-250MG 250 mg

4-Nitrophenyl 4,6-O-Benzylidene-Alpha-D-mannopyranoside

Sign In for Pricing
View Details
Pygopus 2 Rabbit Polyclonal Antibody
R1510-27 100 µL

Pygopus 2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®640R BCN
#92078 1x 500 µg

CF®640R BCN

Sign In for Pricing
View Details
Ɑ-Butyric Acid-ω-Boc Amino PEG
133000-21-32.1G 1 g

Ɑ-Butyric Acid-ω-Boc Amino PEG

Sign In for Pricing
View Details
c-Jun (JUN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A4]
TA800612BM 100 µL

c-Jun (JUN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A4]

Sign In for Pricing
View Details
BBS7 Goat Polyclonal Antibody
AP32056PU-N 100 µg

BBS7 Goat Polyclonal Antibody

Sign In for Pricing
View Details