Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poliovirus receptor (PVR), partial

This Recombinant Human Poliovirus receptor (PVR), partial spans the amino acid sequence from region 21-343aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Nectin-like protein 5) (NECL-5) (CD antigen CD155)

UniProt

P15151

Expression Region

21-343aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fn3k (BC054374) Mouse Tagged ORF Clone
MG202213 10 µg

Fn3k (BC054374) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
C3orf54 (FAM212A) (NM_203370) Human Over-expression Lysate
LC404305 20 µg

C3orf54 (FAM212A) (NM_203370) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS631658 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Iso Cyclosporin H Trifluoroacetic Acid Salt
TRC-I811555-25MG 25 mg

Iso Cyclosporin H Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Recombinant AMPK alpha 1 Antibody
RN-10567-01 50 μL

Recombinant AMPK alpha 1 Antibody

Sign In for Pricing
View Details
Recombinant AMPK alpha 1 Antibody
RN-10567-02 100 µL

Recombinant AMPK alpha 1 Antibody

Sign In for Pricing
View Details