Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntenin-1 (SDCBP)

This Recombinant Human Syntenin-1 (SDCBP) spans the amino acid sequence from region 2-298aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Melanoma differentiation-associated protein 9) (MDA-9) (Pro-TGF-alpha cytoplasmic domain-interacting protein 18) (TACIP18) (Scaffold protein Pbp1) (Syndecan-binding protein 1)

UniProt

O00560

Expression Region

2-298aa

Tag

C-terminal hFc1-Flag-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Growth Differentiation Factor 11 (GDF11) ELISA Kit
RDR-GDF11-Mu-01 96 Tests

Mouse Growth Differentiation Factor 11 (GDF11) ELISA Kit

Sign In for Pricing
View Details
Mouse Growth Differentiation Factor 11 (GDF11) ELISA Kit
RDR-GDF11-Mu-02 48 Tests

Mouse Growth Differentiation Factor 11 (GDF11) ELISA Kit

Sign In for Pricing
View Details
(R)-Imazamox
TRC-I268560-5MG 5 mg

(R)-Imazamox

Sign In for Pricing
View Details
4-Chloroaniline-2,6-d2
TRC-C377501-5MG 5 mg

4-Chloroaniline-2,6-d2

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701749 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
TRPS1 Mouse Monoclonal Antibody [Clone ID: OTI8C11]
CF813180 100 µg

TRPS1 Mouse Monoclonal Antibody [Clone ID: OTI8C11]

Sign In for Pricing
View Details