Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TGF-beta receptor type-1 (TGFBR1), partial

This Recombinant Human TGF-beta receptor type-1 (TGFBR1), partial spans the amino acid sequence from region 34-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TGFR-1) (Activin A receptor type II-like protein kinase of 53kD) (Activin receptor-like kinase 5) (ALK-5) (ALK5) (Serine/threonine-protein kinase receptor R4) (SKR4) (TGF-beta type I receptor) (Transforming growth factor-beta receptor type I) (TGF-beta receptor type I) (TbetaR-I)

UniProt

P36897

Expression Region

34-125aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLN5 knockout cell line
ABC-KH3239 1 Vial

Human CLN5 knockout cell line

Sign In for Pricing
View Details
Human COQ8B Protein Lysate
MBS139791-01 0.02 mg

Human COQ8B Protein Lysate

Sign In for Pricing
View Details
Human COQ8B Protein Lysate
MBS139791-02 5x 0.02 mg

Human COQ8B Protein Lysate

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to BTRC
sAP-1584 50 µg

Mouse Monoclonal Antibody to BTRC

Sign In for Pricing
View Details
PTMAP7 Adenovirus (Human)
38121051 1.0 mL

PTMAP7 Adenovirus (Human)

Sign In for Pricing
View Details
PLV-Tet-miniCMV-HECTD3-GFP-nanobody-mCherry-Puro Plasmid
PVT77835 2 µg

PLV-Tet-miniCMV-HECTD3-GFP-nanobody-mCherry-Puro Plasmid

Sign In for Pricing
View Details