Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial

This Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial spans the amino acid sequence from region 29-216aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ACT35 antigen) (OX40L receptor) (TAX transcriptionally-activated glycoprotein 1 receptor) (CD antigen CD134)

UniProt

P43489

Expression Region

29-216aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL12 CRISPR All-in-one AAV vector set (with saCas9)(Human)
17168151 3x 1.0 µg DNA

CXCL12 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Mouse IgG (H+L chain), F(ab)2 Fragment rabbit polyclonal antibody, Purified
SP1012P 1 mg

Mouse IgG (H+L chain), F(ab)2 Fragment rabbit polyclonal antibody, Purified

Sign In for Pricing
View Details
Anti-NEU3 (Rabbit, Polyclonal)
A117107 100 µL

Anti-NEU3 (Rabbit, Polyclonal)

Sign In for Pricing
View Details
F3 (CD142 Antigen, Coagulation Factor III, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 405)
MBS6416623-01 0.1 mL

F3 (CD142 Antigen, Coagulation Factor III, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 405)

Sign In for Pricing
View Details
F3 (CD142 Antigen, Coagulation Factor III, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 405)
MBS6416623-02 5x 0.1 mL

F3 (CD142 Antigen, Coagulation Factor III, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit CARM1 Antibody
orb1530228-01 10 µL

Rabbit CARM1 Antibody

Sign In for Pricing
View Details