Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vesicular integral-membrane protein VIP36 (LMAN2), partial

This Recombinant Human Vesicular integral-membrane protein VIP36 (LMAN2), partial spans the amino acid sequence from region 45-322aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Glycoprotein GP36b) (Lectin mannose-binding 2) (Vesicular integral-membrane protein 36) (VIP36)

UniProt

Q12907

Expression Region

45-322aa

Tag

N-terminal 6xHis-HA-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOR1AIP1 antibody
FNab08871 100 µg

TOR1AIP1 antibody

Sign In for Pricing
View Details
Human ABH2 (ALKBH2) activation kit by CRISPRa
GA114759 1 Kit

Human ABH2 (ALKBH2) activation kit by CRISPRa

Sign In for Pricing
View Details
IFITM10 (NM_001170820) Human Over-expression Lysate
LY432563 100 µg

IFITM10 (NM_001170820) Human Over-expression Lysate

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF488A conjugate, 0.1mg/mL
BNC881909-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dapivirine-d11
TRC-D185502-1MG 1 mg

Dapivirine-d11

Sign In for Pricing
View Details
Shoc2 Mouse Gene Knockout Kit (CRISPR)
KN515760 1 Kit

Shoc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details