Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vesicular integral-membrane protein VIP36 (LMAN2), partial

This Recombinant Human Vesicular integral-membrane protein VIP36 (LMAN2), partial spans the amino acid sequence from region 45-322aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Glycoprotein GP36b) (Lectin mannose-binding 2) (Vesicular integral-membrane protein 36) (VIP36)

UniProt

Q12907

Expression Region

45-322aa

Tag

N-terminal 6xHis-HA-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMP Human IL-18 Protein
GMP-L18H16-500ug 500 µg

GMP Human IL-18 Protein

Sign In for Pricing
View Details
Cis-11-Eicosenamide
TRC-E101215-25MG 25 mg

Cis-11-Eicosenamide

Sign In for Pricing
View Details
PEG8000, 1kg
PC0921-1kg 1 Kg

PEG8000, 1kg

Sign In for Pricing
View Details
Vmn2r81 Mouse Gene Knockout Kit (CRISPR)
KN519213 1 Kit

Vmn2r81 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hepatitis B Virus (HBV) TaqMan PCR Lyophilized
TM29210L 100 Reactions

Hepatitis B Virus (HBV) TaqMan PCR Lyophilized

Sign In for Pricing
View Details
Chk2 (CHEK2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]
TA500384AM 100 µL

Chk2 (CHEK2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]

Sign In for Pricing
View Details