Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IGF-like family receptor 1 (Igflr1), partial

This Recombinant Mouse IGF-like family receptor 1 (Igflr1), partial spans the amino acid sequence from region 21-163aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Transmembrane protein 149)

UniProt

Q3U4N7

Expression Region

21-163aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASMEASSFCGHLEYWNSDKRCCSRCLQRFGPPACPDHEFTENCGLNDFGDTVAHPFKKCSPGYCNPNGTELCSQCSSGAAAAPAHVESPGRTHKQCRKKPVPPKDVCPLKPEDAGASSSPGRWSLGQTTKNEVSSRPGFVSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFR/PAF Receptor Rabbit Polyclonal Antibody (FITC)
orb16151 100 µL

PAFR/PAF Receptor Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
TRNAD10 3'UTR Lenti-reporter-Luc Vector
47956081 1.0 µg

TRNAD10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Di-tert-Butyl Malonate
446515-01 1 g

Di-tert-Butyl Malonate

Sign In for Pricing
View Details
Di-tert-Butyl Malonate
446515-02 10 g

Di-tert-Butyl Malonate

Sign In for Pricing
View Details
Recombinant Mycobacterium Gilvum dut Protein (aa 1-154)
VAng-Yyj4187-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Gilvum dut Protein (aa 1-154)

Sign In for Pricing
View Details
Lentiviral mouse Mill2 shRNA (UAS) - Lentiviral mouse Mill2 shRNA (UAS) (25)
GTR15190661 1 Vial

Lentiviral mouse Mill2 shRNA (UAS) - Lentiviral mouse Mill2 shRNA (UAS) (25)

Sign In for Pricing
View Details