Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial, Biotinylated

This Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial, Biotinylated spans the amino acid sequence from region 31-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(B- and T-lymphocyte-associated protein) (CD antigen CD272)

UniProt

Q7Z6A9

Expression Region

31-150aa

Tag

C-terminal mFc-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Krt90 (NM_177717) AAV Particle
MR214959A1V 250 µL

Mouse Krt90 (NM_177717) AAV Particle

Sign In for Pricing
View Details
CD25 (IL-2R Alpha Chain) (HRP)
MBS6250501-01 0.1 mL

CD25 (IL-2R Alpha Chain) (HRP)

Sign In for Pricing
View Details
CD25 (IL-2R Alpha Chain) (HRP)
MBS6250501-02 5x 0.1 mL

CD25 (IL-2R Alpha Chain) (HRP)

Sign In for Pricing
View Details
Di-O-methylhonokiol
orb1737440-01 1 mg

Di-O-methylhonokiol

Sign In for Pricing
View Details
Di-O-methylhonokiol
orb1737440-02 1 ml x 10 mM (in DMSO)

Di-O-methylhonokiol

Sign In for Pricing
View Details
Di-O-methylhonokiol
orb1737440-03 5 mg

Di-O-methylhonokiol

Sign In for Pricing
View Details