Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galactocerebrosidase (GALC)

This Recombinant Human Galactocerebrosidase (GALC) spans the amino acid sequence from region 43-685aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GALCERase) (Galactocerebroside beta-galactosidase) (Galactosylceramidase) (Galactosylceramide beta-galactosidase)

UniProt

P54803

Expression Region

43-685aa

Tag

Tag-Free

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFTSGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Florfenicol-d3 Amine
TRC-F405774-1MG 1 mg

Florfenicol-d3 Amine

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF647 conjugate, 0.1mg/mL
BNC471143-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2840), CF647 conjugate, 0.1mg/mL
BNC472840-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2840), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 Mouse Monoclonal Antibody [Clone ID: CCP58]
AM33118PU-T 20 µg

MUC2 Mouse Monoclonal Antibody [Clone ID: CCP58]

Sign In for Pricing
View Details
4-Bromophenol-1,2,3,4,5,6-13C6
TRC-B686406-50MG 50 mg

4-Bromophenol-1,2,3,4,5,6-13C6

Sign In for Pricing
View Details
SQSTM1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A7]
TA502239AM 100 µL

SQSTM1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A7]

Sign In for Pricing
View Details