Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD70 antigen (CD70), partial (Active)

This Recombinant Human CD70 antigen (CD70), partial (Active) spans the amino acid sequence from region 52-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CD27 ligand) (CD27-L) (CD27L) (CD27LG) (TNFSF7)

UniProt

P32970

Expression Region

52-193aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 μg/mL can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL.

Form

Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUFIP2 Protein Lysate (Mouse) with C-HA Tag
32311034 100 µg

NUFIP2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human Lysyl Oxidase Like Protein 3 (LOXL3) ELISA Kit
orb778656-01 48 Tests

Human Lysyl Oxidase Like Protein 3 (LOXL3) ELISA Kit

Sign In for Pricing
View Details
Human Lysyl Oxidase Like Protein 3 (LOXL3) ELISA Kit
orb778656-02 96 Tests

Human Lysyl Oxidase Like Protein 3 (LOXL3) ELISA Kit

Sign In for Pricing
View Details
Anti-SP100 Antibody Picoband® HRP Conjugated
A02051-1-HRP 100 µg/Vial

Anti-SP100 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
Toxyloxanthone D
MBS5790243 Inquire

Toxyloxanthone D

Sign In for Pricing
View Details
EDG-6 shRNA (h) Lentiviral Particles
sc-43747-V 200 µL

EDG-6 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details