Recombinant Macaca fascicularis zymogen granule protein 16 homolog B (ZG16B) (Active)
This Recombinant Macaca fascicularis zymogen granule protein 16 homolog B (ZG16B) (Active) spans the amino acid sequence from region 23-169aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
UniProt
G7Q0A1
Expression Region
23-169aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Cancer Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 90% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody, the EC50 is 20.15-28.98 ng/mL.
Form
Lyophilized powder
Molecular Weight
17.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
AA Sequence
GKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940204-500 1x 500 µL
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742848-100 1x 100 µL
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041207-500 1x 500 µL
CD74 (LN-2 + CLIP/813), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040629-100 1x 100 µL
CD59 (heavy chain of Protectin) (MACIF/629), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472027-500 1x 500 µL
CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details