Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial

This Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial spans the amino acid sequence from region 22-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein A30)

UniProt

Q8V4U9

Expression Region

22-146aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Monkeypox virus (strain Zaire-96-I-16) (MPX)

Field of Research

Infectious Disease & Virology

Dilution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Phospho-Stat6 (Tyr641) Monoclonal Antibody
AN300083L-01 20 µL

Recombinant Phospho-Stat6 (Tyr641) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-Stat6 (Tyr641) Monoclonal Antibody
AN300083L-02 100 µL

Recombinant Phospho-Stat6 (Tyr641) Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS716924 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
FAM195B (MCRIP1) (NM_207368) Human Over-expression Lysate
LY403988 100 µg

FAM195B (MCRIP1) (NM_207368) Human Over-expression Lysate

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1792), CF594 conjugate, 0.1mg/mL
BNC941792-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1792), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), CF740 conjugate, 0.1mg/mL
BNC742743-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details