Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial

This Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial spans the amino acid sequence from region 22-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein A30)

UniProt

Q8V4U9

Expression Region

22-146aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Monkeypox virus (strain Zaire-96-I-16) (MPX)

Field of Research

Infectious Disease & Virology

Dilution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF488A conjugate, 0.1mg/mL
BNC883159-500 1x 500 µL

MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS639846 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details
Flavanone
TRC-F371100-1G 1 g

Flavanone

Sign In for Pricing
View Details
ELAVL2 (NM_001171195) Human Over-expression Lysate
LY432918 100 µg

ELAVL2 (NM_001171195) Human Over-expression Lysate

Sign In for Pricing
View Details
Citric Acid Monohydrate
TRC-C521058-10G 10 g

Citric Acid Monohydrate

Sign In for Pricing
View Details
1-(2H-1,3-benzodioxol-5-yl)prop-2-en-1-ol
TRC-B115020-50MG 50 mg

1-(2H-1,3-benzodioxol-5-yl)prop-2-en-1-ol

Sign In for Pricing
View Details