Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Beta-2-microglobulin (B2M)

This Recombinant Pig Beta-2-microglobulin (B2M) spans the amino acid sequence from region 21-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Lactollin)

UniProt

Q07717

Expression Region

21-118aa

Tag

Tag-free

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC6 (NM_001254) Human Over-expression Lysate
LS000990 100 µg

CDC6 (NM_001254) Human Over-expression Lysate

Sign In for Pricing
View Details
KI18A Rabbit Polyclonal Antibody
JOT-AP10823-01 20 µL

KI18A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KI18A Rabbit Polyclonal Antibody
JOT-AP10823-02 50 μL

KI18A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KI18A Rabbit Polyclonal Antibody
JOT-AP10823-03 100 µL

KI18A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AZD3759 hydrochloride
M18097-01 1 g

AZD3759 hydrochloride

Sign In for Pricing
View Details
AZD3759 hydrochloride
M18097-02 500 mg

AZD3759 hydrochloride

Sign In for Pricing
View Details