Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus Beta-2-microglobulin (B2m)

This Recombinant Mesocricetus auratus Beta-2-microglobulin (B2m) spans the amino acid sequence from region 21-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A1U7QLF7

Expression Region

21-119aa

Tag

Tag-Free

Source

E.coli

Origin

Mesocricetus auratus (Golden hamster)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQRPPQVQVYTRHPPEDGKPNFLNCYVSQFHPPHIEIELLKNGEKMDKVELSDLSFNKDWSFYLLAHREFVPTATDKYACRVSHITLKEPKVVTWERDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIP1 Polyclonal Antibody, HRP Conjugated
bs-20485R-HRP 100 µL

SIP1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
MOBP Protein Vector (Mouse) (pPB-C-His)
PV201430 500 ng

MOBP Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Human CD38 (43-300) Membrane Protein, PaRoom Temperatureial, -Llama IgG2b Fc tag, low endotoxin
MP1118F Each

Magic™ Antibody Discovery - Human CD38 (43-300) Membrane Protein, PaRoom Temperatureial, -Llama IgG2b Fc tag, low endotoxin

Sign In for Pricing
View Details
MASPIN (SERPINB5) (NM_002639) Human Over-expression Lysate
LS005268 100 µg

MASPIN (SERPINB5) (NM_002639) Human Over-expression Lysate

Sign In for Pricing
View Details
MAK sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
27965111 3x 1.0 µg

MAK sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Olfactory Receptor 4F5 (OR4F5) Antibody
abx376202 100 µg

Olfactory Receptor 4F5 (OR4F5) Antibody

Sign In for Pricing
View Details