Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial, Biotinylated

This Recombinant Human Delta-like protein 3 (DLL3), partial, Biotinylated spans the amino acid sequence from region 429-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Drosophila Delta homolog 3) (Delta3)

UniProt

Q9NYJ7

Expression Region

429-492aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL3 Antibody
KC-17234-01 50 μL

ELAVL3 Antibody

Sign In for Pricing
View Details
ELAVL3 Antibody
KC-17234-02 100 µL

ELAVL3 Antibody

Sign In for Pricing
View Details
ELAVL3 Antibody
KC-17234-03 1 mL

ELAVL3 Antibody

Sign In for Pricing
View Details
Octadecyltriethoxysilane
TRC-O148493-500MG 500 mg

Octadecyltriethoxysilane

Sign In for Pricing
View Details
Citric Acid Monohydrate
TRC-C521058-10G 10 g

Citric Acid Monohydrate

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 alpha (CCL20) Human Gene Knockout Kit (CRISPR)
KN204691RB 1 Kit

Macrophage Inflammatory Protein 3 alpha (CCL20) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details