Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial, Biotinylated

This Recombinant Human Delta-like protein 3 (DLL3), partial, Biotinylated spans the amino acid sequence from region 429-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Drosophila Delta homolog 3) (Delta3)

UniProt

Q9NYJ7

Expression Region

429-492aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aquaporin 4 (AQP4) (NM_001650) Human Tagged ORF Clone
RG204693 10 µg

Aquaporin 4 (AQP4) (NM_001650) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cytosolic Phospholipase A2 (cPLA2) Rabbit ELISA Kit
C6052 96 Tests

Cytosolic Phospholipase A2 (cPLA2) Rabbit ELISA Kit

Sign In for Pricing
View Details
Nori® Feline Leptin ELISA Kit
GR188006 96 Well

Nori® Feline Leptin ELISA Kit

Sign In for Pricing
View Details
TMPRSS11D Antibody
42-101 0.1 mg

TMPRSS11D Antibody

Sign In for Pricing
View Details
EN2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV657323 1.0 µg DNA

EN2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
OR4C5 sgRNA CRISPR Lentivector (Human) (Target 1)
K1505302 1.0 µg DNA

OR4C5 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details