Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Melanoma-associated antigen 8 (MAGEA8)

This Recombinant Human Melanoma-associated antigen 8 (MAGEA8) spans the amino acid sequence from region 1-318aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cancer/testis antigen 1.8) (CT1.8) (MAGE-8 antigen)

UniProt

P43361

Expression Region

1-318aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD7/GP40 Protein (Fc Tag)
PKSH033512-01 10 µg

Recombinant Human CD7/GP40 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD7/GP40 Protein (Fc Tag)
PKSH033512-02 50 µg

Recombinant Human CD7/GP40 Protein (Fc Tag)

Sign In for Pricing
View Details
TPM1 Human Gene Knockout Kit (CRISPR)
KN401262 1 Kit

TPM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
B3GAT3 (NM_001288723) Human Tagged ORF Clone
RG237393 10 µg

B3GAT3 (NM_001288723) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS701776 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Serine racemase (SRR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E8]
TA500974BM 100 µL

Serine racemase (SRR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E8]

Sign In for Pricing
View Details