Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin (INS), partial

This Recombinant Bovine Insulin (INS), partial spans the amino acid sequence from region 25-54aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P01317

Expression Region

25-54aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD45 Antibody[HI30]
E-AB-F1137D-01 20 Tests

PE Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
PE Anti-Human CD45 Antibody[HI30]
E-AB-F1137D-02 100 Tests

PE Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
PE Anti-Human CD45 Antibody[HI30]
E-AB-F1137D-03 2x 100 Tests

PE Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Recombinant FOSB Antibody
RC-16800-01 50 μL

Recombinant FOSB Antibody

Sign In for Pricing
View Details
Recombinant FOSB Antibody
RC-16800-02 100 µL

Recombinant FOSB Antibody

Sign In for Pricing
View Details
Recombinant FOSB Antibody
RC-16800-03 1 mL

Recombinant FOSB Antibody

Sign In for Pricing
View Details