Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)

This Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) spans the amino acid sequence from region 27-282aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IBP-7) (IGF-binding protein 7) (IGFBP-7) (IGFBP-rP1) (MAC25 protein) (PGI2-stimulating factor) (Prostacyclin-stimulating factor) (Tumor-derived adhesion factor) (TAF)

UniProt

Q16270

Expression Region

27-282aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cytochrome P450 11A1 (CYP11A1) ELISA Kit
RDR-CYP11A1-Ra-01 96 Tests

Rat Cytochrome P450 11A1 (CYP11A1) ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome P450 11A1 (CYP11A1) ELISA Kit
RDR-CYP11A1-Ra-02 48 Tests

Rat Cytochrome P450 11A1 (CYP11A1) ELISA Kit

Sign In for Pricing
View Details
Iba1 Antibody
orb2808205 100 µL

Iba1 Antibody

Sign In for Pricing
View Details
TRIM16L cDNA Clone
MBS1266541-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TRIM16L cDNA Clone

Sign In for Pricing
View Details
TRIM16L cDNA Clone
MBS1266541-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TRIM16L cDNA Clone

Sign In for Pricing
View Details
Gm12887 (NM_001099309) Mouse Tagged ORF Clone Lentiviral Particle
MR212732L3V 200 µL

Gm12887 (NM_001099309) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details